Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST1H2BN Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

H2B clustered histone 15

Gene Aliases

H2B histone family, member D; H2B/d; H2BFD; HIST1H2BN; histone 1, H2bn; histone cluster 1 H2B family member n; histone cluster 1, H2bn; histone H2B type 1-N; histone H2B.d.

Gene ID

8341

Accession Number

NP_003511.1

Reactivity

Homo sapiens|Human

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

PEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H2BC15

Host or Source

Human

Protein Name

Histone H2B type 1-N

Gene Name URL

H2BC15

Nucleotide Accession Number

NM_003520.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1600015I10Rik CRISPR/Cas9 KO Plasmid (m)
sc-427527 20 µg

1600015I10Rik CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Phospho-Proteasome 20S alpha 3 (Ser250) Rabbit pAb, PerCP-Cy7 conjugated
orb2822990 100 µL

Phospho-Proteasome 20S alpha 3 (Ser250) Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Ets-1 Double Nickase Plasmid (h2)
sc-400461-NIC-2 20 µg

Ets-1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Human EGF Recombinant Protein
CST 72528S 100 µg

Human EGF Recombinant Protein

Sign In for Pricing
View Details
Prostate Specific Antigen (Prostate-specific Antigen, PSA, APS, Gamma-seminoprotein, Kallikrein-3, KLK3, hK3, KLK2A1, P-30 Antigen, Seminin, Semenogelase) (PE)
MBS6262944-01 0.1 mL

Prostate Specific Antigen (Prostate-specific Antigen, PSA, APS, Gamma-seminoprotein, Kallikrein-3, KLK3, hK3, KLK2A1, P-30 Antigen, Seminin, Semenogelase) (PE)

Sign In for Pricing
View Details
Prostate Specific Antigen (Prostate-specific Antigen, PSA, APS, Gamma-seminoprotein, Kallikrein-3, KLK3, hK3, KLK2A1, P-30 Antigen, Seminin, Semenogelase) (PE)
MBS6262944-02 5x 0.1 mL

Prostate Specific Antigen (Prostate-specific Antigen, PSA, APS, Gamma-seminoprotein, Kallikrein-3, KLK3, hK3, KLK2A1, P-30 Antigen, Seminin, Semenogelase) (PE)

Sign In for Pricing
View Details