Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pectate lyase 1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Major pollen allergen Cha o 1.

Reactivity

Chamaecyparis obtusa

Target

Has pectate lyase activity.

Type

Protein

Source

E.coli

Sequence

DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPCS

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

54.1 kDa

Protein Length

Recombinant

Host or Source

Chamaecyparis obtusa

Protein Name

Pectate lyase 1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF568 Human shRNA Lentiviral Particle (Locus ID 374900)
TL300129V 500 µL Each

ZNF568 Human shRNA Lentiviral Particle (Locus ID 374900)

Sign In for Pricing
View Details
Recombinant human HSPG2 protein, N-His
bs-42231P-01 20 µg

Recombinant human HSPG2 protein, N-His

Sign In for Pricing
View Details
Recombinant human HSPG2 protein, N-His
bs-42231P-02 100 µg

Recombinant human HSPG2 protein, N-His

Sign In for Pricing
View Details
Recombinant human HSPG2 protein, N-His
bs-42231P-03 500 µg

Recombinant human HSPG2 protein, N-His

Sign In for Pricing
View Details
BNIP1 Rabbit Polyclonal Antibody (PE-Cy7)
orb888838 100 µL

BNIP1 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Recombinant Caulobacter sp. Serine--tRNA ligase (serS)
MBS1244863-01 0.02 mg (E-Coli)

Recombinant Caulobacter sp. Serine--tRNA ligase (serS)

Sign In for Pricing
View Details