Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFYA3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Nuclear factor Y, subunit A3

Gene Aliases

AT1G72830; ATHAP2C; F3N23.3; F3N23_3; HAP2C; nuclear factor Y; ''nuclear factor Y; nuclear factor Y, subunit A3; subunit A3; subunit A3''; Transcriptional activator HAP2C.

Gene ID

843614

Accession Number

NP_565049.1

Reactivity

Arabidopsis thaliana

Target

Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Type

Protein

Source

E.coli

Sequence

MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADIFGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NF-YA3

Host or Source

Arabidopsis thaliana

Protein Name

Nuclear transcription factor Y subunit A-3

Gene Name URL

NF-YA3

Nucleotide Accession Number

NM_105941.7

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAF-1 p60 (SS 53)
sc-56646 200 µg/mL

CAF-1 p60 (SS 53)

Sign In for Pricing
View Details
Lentiviral human HMGXB3 sgRNA gene knockout kit - Lentiviral human HMGXB3 sgRNA gene knockout kit (plasmid)
GTR15375203 1 Vial

Lentiviral human HMGXB3 sgRNA gene knockout kit - Lentiviral human HMGXB3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Macrophage Inflammatory Protein-1 alpha (MIP-1α)
MO-C40051F-01 0.1 mg

Macrophage Inflammatory Protein-1 alpha (MIP-1α)

Sign In for Pricing
View Details
Macrophage Inflammatory Protein-1 alpha (MIP-1α)
MO-C40051F-02 0.5 mg

Macrophage Inflammatory Protein-1 alpha (MIP-1α)

Sign In for Pricing
View Details
Rab 4A CRISPR Activation Plasmid (m2)
sc-422565-ACT-2 20 µg

Rab 4A CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
ZNF341 (h) -PR
sc-76981-PR 10 µM - 20 µL

ZNF341 (h) -PR

Sign In for Pricing
View Details