Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DDB1 and CUL4 associated factor 4

Gene Aliases

DDB1- and CUL4-associated factor 4; WD repeat domain 21A; WD repeat-containing protein 21A; WDR21; WDR21A.

Gene ID

26094

Accession Number

NP_001156980.1

Reactivity

Homo sapiens|Human

Target

May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.

Type

Protein

Source

E.coli

Sequence

MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIARMGFNASSMLRKSQLGFLNVTNYCHLAHELRLSCMERKKVQIRSMDPSALASDRFNLILADTNSDRLFTVNDVKVGGSKYGIINLQSLKTPTLKVFMHENLYFTNRKVNSVCWASLNHLDSHILLCLMGLAETPGCATLLPASLFVNSHPGIDRPGMLCSFRIPGAWSCAWSLNIQANNCFSTGLSRRVLLTNVVTGHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKATRLFHDSAVTSVRILQDEQYLMASDMAGKIKLWDLRTTKCVRQYEGHVNEYAYLPLHVHEEEGILVAVGQDCYTRIWSLHDARLLRTIPSPYPASKADIPSVAFSSRLGGSRGAPGLLMAVGQDLYCYSYS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

71.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DCAF4

Host or Source

Human

Protein Name

DDB1- and CUL4-associated factor 4

Gene Name URL

DCAF4

Nucleotide Accession Number

NM_001163508.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-B, ID (HLA-B, HLAB, HLA class I histocompatibility antigen, B-7 alpha chain, MHC class I antigen B*7) (Azide free) (HRP)
MBS6307037-01 0.2 mL

HLA-B, ID (HLA-B, HLAB, HLA class I histocompatibility antigen, B-7 alpha chain, MHC class I antigen B*7) (Azide free) (HRP)

Sign In for Pricing
View Details
HLA-B, ID (HLA-B, HLAB, HLA class I histocompatibility antigen, B-7 alpha chain, MHC class I antigen B*7) (Azide free) (HRP)
MBS6307037-02 5x 0.2 mL

HLA-B, ID (HLA-B, HLAB, HLA class I histocompatibility antigen, B-7 alpha chain, MHC class I antigen B*7) (Azide free) (HRP)

Sign In for Pricing
View Details
Ubenimex Impurity 6
RM-U021406-01 10 mg

Ubenimex Impurity 6

Sign In for Pricing
View Details
Ubenimex Impurity 6
RM-U021406-02 25 mg

Ubenimex Impurity 6

Sign In for Pricing
View Details
Ubenimex Impurity 6
RM-U021406-03 50 mg

Ubenimex Impurity 6

Sign In for Pricing
View Details
Ubenimex Impurity 6
RM-U021406-04 100 mg

Ubenimex Impurity 6

Sign In for Pricing
View Details