What is the catalog number for SARAF Recombinant Protein?

The catalog number for SARAF Recombinant Protein is OPCA02431-1MG.

What sizes are available for SARAF Recombinant Protein?

SARAF Recombinant Protein is available in the following size(s): 1 mg.

Is SARAF Recombinant Protein in stock?

SARAF Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

SARAF Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Store-operated calcium entry associated regulatory factor

Gene Aliases

FOAP-7; HBV XAg-transactivated protein 3; HBV X-transactivated gene 3 protein; HSPC035; Protein FOAP-7; SOCE-associated regulatory factor; store-operated calcium entry-associated regulatory factor; testicular secretory protein Li 59; TMEM66; transmembrane protein 66; XTP3.

Gene ID

51669

Accession Number

NP_001271168.1

Reactivity

Homo sapiens|Human

Target

Negative regulator of store-operated Ca (2+) entry (SOCE) involved in protecting cells from Ca (2+) overfilling. In response to cytosolic Ca (2+) elevation after endoplasmic reticulum Ca (2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2) -dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca (2+) levels, and thus preventing the overload of the cell with excessive Ca (2+) ions.

Type

Protein

Source

E.coli

Sequence

SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.