What is the catalog number for PSMF1 Recombinant Protein?

The catalog number for PSMF1 Recombinant Protein is OPCA02430-20UG.

What sizes are available for PSMF1 Recombinant Protein?

PSMF1 Recombinant Protein is available in the following size(s): 20 µg.

Is PSMF1 Recombinant Protein in stock?

PSMF1 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

PSMF1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Proteasome inhibitor subunit 1

Gene Aliases

PI31; proteasome (prosome, macropain) inhibitor subunit 1 (PI31) ; proteasome inhibitor PI31 subunit.

Gene ID

9491

Accession Number

NP_006805.2

Reactivity

Homo sapiens|Human

Target

Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28.

Type

Protein

Source

E.coli

Sequence

MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.