What is the catalog number for DAND5 Recombinant Protein?

The catalog number for DAND5 Recombinant Protein is OPCA02426-100UG.

What sizes are available for DAND5 Recombinant Protein?

DAND5 Recombinant Protein is available in the following size(s): 100 µg.

Is DAND5 Recombinant Protein in stock?

DAND5 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

DAND5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DAN domain BMP antagonist family member 5

Gene Aliases

CER2; cerberus 2; cerberus-like 2; cerberus-like protein 2; cerl-2; CERL2; CKTSF1B3; COCO; CRL2; cysteine knot superfamily 1, BMP antagonist 3; DAN domain family member 5; DAN domain family member 5, BMP antagonist; DAN domain family, member 5; DANTE; GREM3; gremlin-3; SP1.

Gene ID

199699

Accession Number

NP_689867.1

Reactivity

Homo sapiens|Human

Target

Seems to play a role in the correct specification of the left-right axis. May antagonize NODAL and BMP4 signaling. Cystine knot-containing proteins play important roles during development, organogenesis, tissue growth and differentiation (By similarity) .

Type

Protein

Source

E.coli

Sequence

RPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.