Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAND5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DAN domain BMP antagonist family member 5

Gene Aliases

CER2; cerberus 2; cerberus-like 2; cerberus-like protein 2; cerl-2; CERL2; CKTSF1B3; COCO; CRL2; cysteine knot superfamily 1, BMP antagonist 3; DAN domain family member 5; DAN domain family member 5, BMP antagonist; DAN domain family, member 5; DANTE; GREM3; gremlin-3; SP1.

Gene ID

199699

Accession Number

NP_689867.1

Reactivity

Homo sapiens|Human

Target

Seems to play a role in the correct specification of the left-right axis. May antagonize NODAL and BMP4 signaling. Cystine knot-containing proteins play important roles during development, organogenesis, tissue growth and differentiation (By similarity) .

Type

Protein

Source

E.coli

Sequence

RPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DAND5

Host or Source

Human

Protein Name

DAN domain family member 5

Gene Name URL

DAND5

Nucleotide Accession Number

NM_152654.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiUse™ Disposable PD-10 Desalting Column
60504-AAT 5 Columns

ReadiUse™ Disposable PD-10 Desalting Column

Sign In for Pricing
View Details
KYNU Antibody (Biotin)
KB-2900-01 50 μL

KYNU Antibody (Biotin)

Sign In for Pricing
View Details
KYNU Antibody (Biotin)
KB-2900-02 100 µL

KYNU Antibody (Biotin)

Sign In for Pricing
View Details
KYNU Antibody (Biotin)
KB-2900-03 1 mL

KYNU Antibody (Biotin)

Sign In for Pricing
View Details
Human TNC (Tenascin C) ELISA Kit
E-EL-H6198-01 24 Tests

Human TNC (Tenascin C) ELISA Kit

Sign In for Pricing
View Details
Human TNC (Tenascin C) ELISA Kit
E-EL-H6198-02 48 Tests

Human TNC (Tenascin C) ELISA Kit

Sign In for Pricing
View Details