Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Coiled-coil-helix-coiled-coil-helix domain containing 4

Gene Aliases

Coiled-coil-helix-coiled-coil-helix domain-containing protein 4; MIA40; mitochondrial intermembrane space import and assembly protein 40; TIMM40; translocase of inner mitochondrial membrane 40 homolog.

Gene ID

131474

Accession Number

NP_001091972.1

Reactivity

Homo sapiens|Human

Target

Functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17, COX19 and MICU1 (PubMed:16185709, PubMed:26387864, PubMed:19182799, PubMed:21059946, PubMed:23186364, PubMed:23676665) . Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS) . Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS (PubMed:16185709, PubMed:19182799, PubMed:21059946, PubMed:23676665) . Reduced CHCHD4/MIA40 is then reoxidized by GFER/ERV1 via a disulfide relay system (PubMed:23186364) . Mediates formation of disulfide bond in MICU1 in the IMS, promoting formation of the MICU1-MICU2 heterodimer that regulates mitochondrial calcium uptake (PubMed:26387864) .

Type

Protein

Source

E.coli

Sequence

MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CHCHD4

Host or Source

Human

Protein Name

Mitochondrial intermembrane space import and assembly protein 40

Gene Name URL

CHCHD4

Nucleotide Accession Number

NM_001098502.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain 2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61574R-BF750-TR 20 µL

Calpain 2 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
RPL9P11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1896105 3x 1.0 µg

RPL9P11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
NEU4 siRNA (Human)
MBS8205619-01 15 nmol

NEU4 siRNA (Human)

Sign In for Pricing
View Details
NEU4 siRNA (Human)
MBS8205619-02 30 nmol

NEU4 siRNA (Human)

Sign In for Pricing
View Details
NEU4 siRNA (Human)
MBS8205619-03 5x 30 nmol

NEU4 siRNA (Human)

Sign In for Pricing
View Details
Research Grade Anti-Human DCBLD2CLCP1 Antibody (FA19-1)
DHN05401 100 μg

Research Grade Anti-Human DCBLD2CLCP1 Antibody (FA19-1)

Sign In for Pricing
View Details