Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESAM Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Endothelial cell adhesion molecule

Gene Aliases

2310008D05Rik; endothelial cell-selective adhesion molecule; HUEL (C4orf1) -interacting protein; LP4791 protein; W117m.

Gene ID

90952

Accession Number

NP_620411.2

Reactivity

Homo sapiens|Human

Target

Can mediate aggregation most likely through a homophilic molecular interaction.

Type

Protein

Source

E.coli

Sequence

QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ESAM

Host or Source

Human

Protein Name

Endothelial cell-selective adhesion molecule

Gene Name URL

ESAM

Nucleotide Accession Number

NM_138961.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF2 Antibody, Biotin conjugated
MBS1496231-01 0.05 mg

GDF2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
GDF2 Antibody, Biotin conjugated
MBS1496231-02 0.1 mg

GDF2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
GDF2 Antibody, Biotin conjugated
MBS1496231-03 5x 0.1 mg

GDF2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
EIF2C1, NT (Protein Argonaute-1, Argonaute1, hAgo1, Eukaryotic Translation Initiation Factor 2C 1, eIF-2C 1, eIF2C 1, Putative RNA-binding Protein Q99, AGO1) (HRP)
MBS6473677-01 0.2 mL

EIF2C1, NT (Protein Argonaute-1, Argonaute1, hAgo1, Eukaryotic Translation Initiation Factor 2C 1, eIF-2C 1, eIF2C 1, Putative RNA-binding Protein Q99, AGO1) (HRP)

Sign In for Pricing
View Details
EIF2C1, NT (Protein Argonaute-1, Argonaute1, hAgo1, Eukaryotic Translation Initiation Factor 2C 1, eIF-2C 1, eIF2C 1, Putative RNA-binding Protein Q99, AGO1) (HRP)
MBS6473677-02 5x 0.2 mL

EIF2C1, NT (Protein Argonaute-1, Argonaute1, hAgo1, Eukaryotic Translation Initiation Factor 2C 1, eIF-2C 1, eIF2C 1, Putative RNA-binding Protein Q99, AGO1) (HRP)

Sign In for Pricing
View Details
Inhalac 120 (contains b anomer)
I188120 250 g

Inhalac 120 (contains b anomer)

Sign In for Pricing
View Details