Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NABP1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Nucleic acid binding protein 1

Gene Aliases

Nucleic acid-binding protein 1; OBFC2A; oligonucleotide/oligosaccharide-binding fold containing 2A; oligonucleotide/oligosaccharide-binding fold-containing protein 2A; sensor of single-strand DNA complex subunit B2; sensor of ssDNA subunit B2; single-stranded DNA-binding protein 2; SOSS complex subunit B2; SOSS-B2; SSB2.

Gene ID

64859

Accession Number

NP_001026886.1

Reactivity

Homo sapiens|Human

Target

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.

Type

Protein

Source

E.coli

Sequence

MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NABP1

Host or Source

Human

Protein Name

SOSS complex subunit B2

Gene Name URL

NABP1

Nucleotide Accession Number

NM_001031716.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Twist2  (1E2)
YF-MA19777 100 ug

Anti-Twist2 (1E2)

Sign In for Pricing
View Details
Myelin Basic Protein (68-82), guinea pig
A1031-5 5 mg

Myelin Basic Protein (68-82), guinea pig

Sign In for Pricing
View Details
Uromodulin (UMOD, Tamm-Horsfall Urinary Glycoprotein, THP) (MaxLight 550)
MBS6398036-01 0.1 mL

Uromodulin (UMOD, Tamm-Horsfall Urinary Glycoprotein, THP) (MaxLight 550)

Sign In for Pricing
View Details
Uromodulin (UMOD, Tamm-Horsfall Urinary Glycoprotein, THP) (MaxLight 550)
MBS6398036-02 5x 0.1 mL

Uromodulin (UMOD, Tamm-Horsfall Urinary Glycoprotein, THP) (MaxLight 550)

Sign In for Pricing
View Details
Anti-GRO alpha/Cxcl1 Antibody Picoband® (PE Conjugate)
A00533-PE 100 µg/Vial

Anti-GRO alpha/Cxcl1 Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
YdfH Antibody
orb831482 2 mg

YdfH Antibody

Sign In for Pricing
View Details