Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALKBH3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

AlkB homolog 3, alpha-ketoglutarate dependent dioxygenase

Gene Aliases

ABH3; alkB homolog 3, alpha-ketoglutaratedependent dioxygenase; alkB, alkylation repair homolog 3; alkylated DNA repair protein alkB homolog 3; alpha-ketoglutarate-dependent dioxygenase alkB homolog 3; DEPC1; DEPC-1; hABH3; PCA1; Prostate cancer antigen 1; prostate cancer antigen-1.

Gene ID

221120

Accession Number

NP_631917.1

Reactivity

Homo sapiens|Human

Target

Dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A) (PubMed:12486230, PubMed:12594517, PubMed:16174769, PubMed:26863196, PubMed:26863410) . Repairs alkylated DNA containing 1-methyladenosine (m1A) and 3-methylcytosine (m3C) by oxidative demethylation (PubMed:12486230, PubMed:12594517, PubMed:16174769, PubMed:25944111) . Has a strong preference for single-stranded DNA (PubMed:12486230, PubMed:12594517, PubMed:16174769) . Able to process alkylated m3C within double-stranded regions via its interaction with ASCC3, which promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3 (PubMed:22055184) . Also acts on RNA (PubMed:12594517, PubMed:16174769, PubMed:26863196, PubMed:26863410, PubMed:16858410) . Demethylates N (1) -methyladenosine (m1A) RNA, an epigenetic internal modification of messenger RNAs (mRNAs) highly enriched within 5'-untranslated regions (UTRs) and in the vicinity of start codons (PubMed:26863196, PubMed:26863410) . Requires molecular oxygen, alpha-ketoglutarate and iron (PubMed:22055184, PubMed:16858410) .

Type

Protein

Source

E.coli

Sequence

MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPRVIEEGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIREDSILQLTFKKSAPVSGTATAPQSCWYERPSPPHIPGPAILTRTRLWAP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ALKBH3

Host or Source

Human

Protein Name

Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3

Gene Name URL

ALKBH3

Nucleotide Accession Number

NM_139178.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pancreatic Polypeptide (PP) ELISA Kit
RDR-PPY-Mu-01 96 Tests

Mouse Pancreatic Polypeptide (PP) ELISA Kit

Sign In for Pricing
View Details
Mouse Pancreatic Polypeptide (PP) ELISA Kit
RDR-PPY-Mu-02 48 Tests

Mouse Pancreatic Polypeptide (PP) ELISA Kit

Sign In for Pricing
View Details
Ɑ-Butyric Acid-ω-Mercaptopropanamido PEG
135000-4-32.1G 1 g

Ɑ-Butyric Acid-ω-Mercaptopropanamido PEG

Sign In for Pricing
View Details
S Protein SARS-CoV-2 Recombinant Protein
TP724023 100 µg

S Protein SARS-CoV-2 Recombinant Protein

Sign In for Pricing
View Details
Human Relaxin 1 (RLN1) activation kit by CRISPRa
GA104105 1 Kit

Human Relaxin 1 (RLN1) activation kit by CRISPRa

Sign In for Pricing
View Details
N-(2-Hydroxyethyl)-1-deoxy-L-altronojirimycin Hydrochloride Salt
TRC-H942000-0.5MG 0.5 mg

N-(2-Hydroxyethyl)-1-deoxy-L-altronojirimycin Hydrochloride Salt

Sign In for Pricing
View Details