Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMX3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Thioredoxin related transmembrane protein 3

Gene Aliases

PDIA13; protein disulfide isomerase family A, member 13; protein disulfide-isomerase TMX3; thioredoxin domain containing 10; thioredoxin domain-containing protein 10; Thioredoxin-related transmembrane protein 3; TXNDC10.

Gene ID

54495

Accession Number

NP_061895.3

Reactivity

Homo sapiens|Human

Target

Probable disulfide isomerase, which participates in the folding of proteins containing disulfide bonds. May act as a dithiol oxidase.

Type

Protein

Source

E.coli

Sequence

KGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEVIFKI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TMX3

Host or Source

Human

Protein Name

Protein disulfide-isomerase TMX3

Gene Name URL

TMX3

Nucleotide Accession Number

NM_019022.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dph2 siRNA Oligos set (Mouse)
18533174 3x 5 nmol

Dph2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant Xanthomonas axonopodis pv. citri Heat-inducible transcription repressor HrcA (hrcA)
MBS1469674-01 0.02 mg (E-Coli)

Recombinant Xanthomonas axonopodis pv. citri Heat-inducible transcription repressor HrcA (hrcA)

Sign In for Pricing
View Details
Recombinant Xanthomonas axonopodis pv. citri Heat-inducible transcription repressor HrcA (hrcA)
MBS1469674-02 0.02 mg (Yeast)

Recombinant Xanthomonas axonopodis pv. citri Heat-inducible transcription repressor HrcA (hrcA)

Sign In for Pricing
View Details
Recombinant Xanthomonas axonopodis pv. citri Heat-inducible transcription repressor HrcA (hrcA)
MBS1469674-03 0.1 mg (E-Coli)

Recombinant Xanthomonas axonopodis pv. citri Heat-inducible transcription repressor HrcA (hrcA)

Sign In for Pricing
View Details
Recombinant Xanthomonas axonopodis pv. citri Heat-inducible transcription repressor HrcA (hrcA)
MBS1469674-04 0.1 mg (Yeast)

Recombinant Xanthomonas axonopodis pv. citri Heat-inducible transcription repressor HrcA (hrcA)

Sign In for Pricing
View Details
Recombinant Xanthomonas axonopodis pv. citri Heat-inducible transcription repressor HrcA (hrcA)
MBS1469674-05 0.02 mg (Baculovirus)

Recombinant Xanthomonas axonopodis pv. citri Heat-inducible transcription repressor HrcA (hrcA)

Sign In for Pricing
View Details