DTD2 Recombinant Protein

Animalia-specifc tRNA deacylase; animalia-specific tRNA deacylase; ATD; C14orf126; D-aminoacyl-tRNA deacylase 2; D-tyrosyl-tRNA deacylase 2 (putative) ; D-tyrosyl-tRNA (Tyr) deacylase 2; L-alanyl-tRNA deacylase; probable D-tyrosyl-tRNA (Tyr) deacylase 2; putative D-tyrosyl-tRNA deacylase 2; putative D-tyrosyl-tRNA (Tyr) deacylase 2.

Deacylates mischarged D-aminoacyl-tRNAs (By similarity) . Probably acts by rejecting L-amino acids from its binding site rather than specific recognition of D-amino acids (By similarity) . Catalyzes the hydrolysis of D-tyrosyl-tRNA (Tyr), has no activity on correctly charged L-tyrosyl-tRNA (Tyr) (By similarity) . By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality. In contrast to DTD1, deacylates L-Ala mischarged on tRNA (Thr) (G4.U69) by alanine-tRNA ligase AARS (PubMed:29410408) . Can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site (PubMed:29410408) . Also hydrolyzes correctly charged, achiral, glycyl-tRNA (Gly) in vitro, although in vivo EEF1A1/EF-Tu may protect cognate achiral glycyl-tRNA (Gly) from DTD2-mediated deacetylation (By similarity) .

MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.