What is the catalog number for DTD2 Recombinant Protein?

The catalog number for DTD2 Recombinant Protein is OPCA02412-1MG.

What sizes are available for DTD2 Recombinant Protein?

DTD2 Recombinant Protein is available in the following size(s): 1 mg.

Is DTD2 Recombinant Protein in stock?

DTD2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

DTD2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

D-aminoacyl-tRNA deacylase 2

Gene Aliases

Animalia-specifc tRNA deacylase; animalia-specific tRNA deacylase; ATD; C14orf126; D-aminoacyl-tRNA deacylase 2; D-tyrosyl-tRNA deacylase 2 (putative) ; D-tyrosyl-tRNA (Tyr) deacylase 2; L-alanyl-tRNA deacylase; probable D-tyrosyl-tRNA (Tyr) deacylase 2; putative D-tyrosyl-tRNA deacylase 2; putative D-tyrosyl-tRNA (Tyr) deacylase 2.

Gene ID

112487

Accession Number

NP_542395.1

Reactivity

Homo sapiens|Human

Target

Deacylates mischarged D-aminoacyl-tRNAs (By similarity) . Probably acts by rejecting L-amino acids from its binding site rather than specific recognition of D-amino acids (By similarity) . Catalyzes the hydrolysis of D-tyrosyl-tRNA (Tyr), has no activity on correctly charged L-tyrosyl-tRNA (Tyr) (By similarity) . By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality. In contrast to DTD1, deacylates L-Ala mischarged on tRNA (Thr) (G4.U69) by alanine-tRNA ligase AARS (PubMed:29410408) . Can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site (PubMed:29410408) . Also hydrolyzes correctly charged, achiral, glycyl-tRNA (Gly) in vitro, although in vivo EEF1A1/EF-Tu may protect cognate achiral glycyl-tRNA (Gly) from DTD2-mediated deacetylation (By similarity) .

Type

Protein

Source

E.coli

Sequence

MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DTD2

Host or Source

Human

Protein Name

D-aminoacyl-tRNA deacylase 2

Gene Name URL

DTD2

Nucleotide Accession Number

NM_080664.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNC680324-500 1x 500 µL