Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRG1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Killer cell lectin like receptor G1

Gene Aliases

2F1; CLEC15A; C-type lectin domain family 15 member A; ITIM-containing receptor MAFA-L; killer cell lectin-like receptor subfamily G member 1; killer cell lectin-like receptor subfamily G, member 1; MAFA; MAFA-2F1; MAFA-L; MAFA-LIKE; MAFA-like receptor; Mast cell function-associated antigen; mast cell function-associated antigen (ITIM-containing) .

Gene ID

10219

Accession Number

NP_005801.3

Reactivity

Homo sapiens|Human

Target

Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells.

Type

Protein

Source

E.coli

Sequence

LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

KLRG1

Host or Source

Human

Protein Name

Killer cell lectin-like receptor subfamily G member 1

Gene Name URL

KLRG1

Nucleotide Accession Number

NM_005810.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP11 Recombinant Antibody, APC-Cy7 Conjugated
bsm-61387R-APC-Cy7 100 µL

BMP11 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Zfp457 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
50985064 1.0 µg DNA

Zfp457 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
pLVX-U6-DNMT1-shRNA1-PGK-EGFP-E2A-Puro Plasmid
PVT32592 2 µg

pLVX-U6-DNMT1-shRNA1-PGK-EGFP-E2A-Puro Plasmid

Sign In for Pricing
View Details
Anti-CISY (Citrate Synthase, Mitochondrial, CS)
MBS625987-01 0.1 mL

Anti-CISY (Citrate Synthase, Mitochondrial, CS)

Sign In for Pricing
View Details
Anti-CISY (Citrate Synthase, Mitochondrial, CS)
MBS625987-02 5x 0.1 mL

Anti-CISY (Citrate Synthase, Mitochondrial, CS)

Sign In for Pricing
View Details
Slc5a11 CRISPR Activation Plasmid (m)
sc-433307-ACT 20 µg

Slc5a11 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details