Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD14B Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Abhydrolase domain containing 14B

Gene Aliases

Abhydrolase domain-containing protein 14B; alpha/beta hydrolase domain-containing protein 14B; CCG1-interacting factor B; cell cycle gene 1-interacting factor B; CIB; epididymis secretory protein Li 299; epididymis secretory sperm binding protein; HEL-S-299; protein ABHD14B.

Gene ID

84836

Reactivity

Homo sapiens|Human

Target

Has hydrolase activity towards p-nitrophenyl butyrate (in vitro) . May activate transcription.

Type

Protein

Source

E.coli

Sequence

AASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ABHD14B

Host or Source

Human

Protein Name

Protein ABHD14B

Gene Name URL

ABHD14B

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Troponin I fast skeletal muscle (TNNI2) (NM_001145841) Human Over-expression Lysate
LC429025 20 µg

Troponin I fast skeletal muscle (TNNI2) (NM_001145841) Human Over-expression Lysate

Sign In for Pricing
View Details
AATOM™ 495 maleimide
70222-AAT 1 mg

AATOM™ 495 maleimide

Sign In for Pricing
View Details
Human OVOL2 activation kit by CRISPRa
GA111778 1 Kit

Human OVOL2 activation kit by CRISPRa

Sign In for Pricing
View Details
SETBP1 Antibody (Biotin)
KB-7801-01 50 μL

SETBP1 Antibody (Biotin)

Sign In for Pricing
View Details
SETBP1 Antibody (Biotin)
KB-7801-02 100 µL

SETBP1 Antibody (Biotin)

Sign In for Pricing
View Details
SETBP1 Antibody (Biotin)
KB-7801-03 1 mL

SETBP1 Antibody (Biotin)

Sign In for Pricing
View Details