What is the catalog number for ABHD14B Recombinant Protein?

The catalog number for ABHD14B Recombinant Protein is OPCA02394-100UG.

What sizes are available for ABHD14B Recombinant Protein?

ABHD14B Recombinant Protein is available in the following size(s): 100 µg.

Is ABHD14B Recombinant Protein in stock?

ABHD14B Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

ABHD14B Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Abhydrolase domain containing 14B

Gene Aliases

Abhydrolase domain-containing protein 14B; alpha/beta hydrolase domain-containing protein 14B; CCG1-interacting factor B; cell cycle gene 1-interacting factor B; CIB; epididymis secretory protein Li 299; epididymis secretory sperm binding protein; HEL-S-299; protein ABHD14B.

Gene ID

84836

Reactivity

Homo sapiens|Human

Target

Has hydrolase activity towards p-nitrophenyl butyrate (in vitro) . May activate transcription.

Type

Protein

Source

E.coli

Sequence

AASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.