Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2W Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquitin conjugating enzyme E2 W

Gene Aliases

E2 ubiquitin-conjugating enzyme W; N-terminal E2 ubiquitin-conjugating enzyme; N-terminus-conjugating E2; UBC16; UBC-16; ubiquitin carrier protein W; ubiquitin conjugating enzyme E2 W (putative) ; ubiquitin conjugating enzyme E2W (putative) ; ubiquitin-conjugating enzyme 16; ubiquitin-conjugating enzyme 2W; ubiquitin-conjugating enzyme E2 W; ubiquitin-protein ligase W.

Gene ID

55284

Accession Number

NP_001001481.2

Reactivity

Homo sapiens|Human

Target

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins (PubMed:20061386) . Specifically monoubiquitinates the N-terminus of various substrates, including ATXN3, MAPT/TAU, POLR2H/RPB8 and STUB1/CHIP, by recognizing backbone atoms of disordered N-termini (PubMed:23560854, PubMed:23696636, PubMed:25436519) . Involved in degradation of misfolded chaperone substrates by mediating monoubiquitination of STUB1/CHIP, leading to recruitment of ATXN3 to monoubiquitinated STUB1/CHIP, and restriction of the length of ubiquitin chain attached to STUB1/CHIP substrates by ATXN3. After UV irradiation, but not after mitomycin-C (MMC) treatment, acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway (PubMed:19111657, PubMed:21229326) . In vitro catalyzes 'Lys-11'-linked polyubiquitination. UBE2W-catalyzed ubiquitination occurs also in the presence of inactive RING/U-box type E3s, i.e. lacking the active site cysteine residues to form thioester bonds with ubiquitin, or even in the absence of E3, albeit at a slower rate (PubMed:25436519) .

Type

Protein

Source

E.coli

Sequence

MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UBE2W

Host or Source

Human

Protein Name

Ubiquitin-conjugating enzyme E2 W

Gene Name URL

UBE2W

Nucleotide Accession Number

NM_001001481.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRD5A3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
45446154 3x 1.0 µg DNA

SRD5A3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
CARD18, Recombinant, Human, aa1-90, His-Tag (Caspase recruitment Domain-containing protein 18, ICEBERG, Pseudo-ICE, UNQ5804)
351122-01 50 µg

CARD18, Recombinant, Human, aa1-90, His-Tag (Caspase recruitment Domain-containing protein 18, ICEBERG, Pseudo-ICE, UNQ5804)

Sign In for Pricing
View Details
CARD18, Recombinant, Human, aa1-90, His-Tag (Caspase recruitment Domain-containing protein 18, ICEBERG, Pseudo-ICE, UNQ5804)
351122-02 250 µg

CARD18, Recombinant, Human, aa1-90, His-Tag (Caspase recruitment Domain-containing protein 18, ICEBERG, Pseudo-ICE, UNQ5804)

Sign In for Pricing
View Details
Rabbit Anti IL21R Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)
IRBAMLIL21RAP727200UL 1 Each

Rabbit Anti IL21R Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)

Sign In for Pricing
View Details
TMM-K-PK AB Labels
054585 Pack of 3750 Label(s)

TMM-K-PK AB Labels

Sign In for Pricing
View Details
VAMP3 Antibody (Center)
MBS9204928-01 0.08 mL

VAMP3 Antibody (Center)

Sign In for Pricing
View Details