What is the catalog number for IL1F10 Recombinant Protein?

The catalog number for IL1F10 Recombinant Protein is OPCA02381-20UG.

What sizes are available for IL1F10 Recombinant Protein?

IL1F10 Recombinant Protein is available in the following size(s): 20 µg.

Is IL1F10 Recombinant Protein in stock?

IL1F10 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

IL1F10 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 1 family member 10

Gene Aliases

Family of interleukin 1-theta; FIL1 theta; FIL1-theta; FKSG75; IL-1 theta; IL-1F10 (canonical form IL-1F10a) ; IL1HY2; IL-1HY2; IL1-theta; IL-38; interleukin 1 family member 10 (theta) ; interleukin-1 family member 10; interleukin-1 HY2; interleukin-1 receptor antagonist FKSG75; interleukin-1 receptor antagonist-like FIL1 theta; Interleukin-1 theta; interleukin-38.

Gene ID

84639

Accession Number

NP_115945.4

Reactivity

Homo sapiens|Human

Target

Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS) . Ligand for IL-36R/IL1RL2.

Type

Protein

Source

E.coli

Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.