Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYDC2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DPY30 domain containing 2

Gene Aliases

DPY30 domain-containing protein 2.

Gene ID

84332

Accession Number

NP_001256970.1

Reactivity

Homo sapiens|Human

Target

This gene encodes a member of a family of proteins that contains a DPY30 domain. This gene locus overlaps with a closely related gene on the opposite strand. Alternative splicing results in multiple transcript variants.

Type

Protein

Source

E.coli

Sequence

METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DYDC2

Host or Source

Human

Protein Name

DPY30 domain-containing protein 2

Gene Name URL

DYDC2

Nucleotide Accession Number

NM_001270041.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNAR2 Protein Vector (Mouse) (pPM-C-HA)
PV190780 500 ng

IFNAR2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CSF2RA (Colony Stimulating Factor 2 Receptor Alpha, CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, MGC3848, MGC4838) (MaxLight 650)
MBS6412622-01 0.1 mL

CSF2RA (Colony Stimulating Factor 2 Receptor Alpha, CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, MGC3848, MGC4838) (MaxLight 650)

Sign In for Pricing
View Details
CSF2RA (Colony Stimulating Factor 2 Receptor Alpha, CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, MGC3848, MGC4838) (MaxLight 650)
MBS6412622-02 5x 0.1 mL

CSF2RA (Colony Stimulating Factor 2 Receptor Alpha, CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, MGC3848, MGC4838) (MaxLight 650)

Sign In for Pricing
View Details
Sult5a1 Protein Vector (Rat) (pPM-C-His)
PV308953 500 ng

Sult5a1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Filensin (BFSP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C3]
TA804080BM 100 µL

Filensin (BFSP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C3]

Sign In for Pricing
View Details
UGT1A10 Protein Vector (Human) (pPB-N-His)
PV045242 500 ng

UGT1A10 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details