Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM10 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

LSM10, U7 small nuclear RNA associated

Gene Aliases

MST074; MSTP074; U7 snRNA-associated Sm-like protein LSm10; U7 snRNP-specific Sm-like protein LSM10.

Gene ID

84967

Accession Number

NP_116270.1

Reactivity

Homo sapiens|Human

Target

Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.

Type

Protein

Source

E.coli

Sequence

MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LSM10

Host or Source

Human

Protein Name

U7 snRNA-associated Sm-like protein LSm10

Gene Name URL

LSM10

Nucleotide Accession Number

NM_032881.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf99 (NM_001302839) Human Tagged ORF Clone
RG235826 10 µg

C6orf99 (NM_001302839) Human Tagged ORF Clone

Sign In for Pricing
View Details
PorcinegyBac transposable element-derived protein 5 (PGBD5) Human ELISA Kit
F8871 96 Tests

PorcinegyBac transposable element-derived protein 5 (PGBD5) Human ELISA Kit

Sign In for Pricing
View Details
ITGB2 (Integrin, beta 2 (Complement Component 3 Receptor 3 and 4 Subunit), CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7) (AP) discontinued
247760-AP 100 µL

ITGB2 (Integrin, beta 2 (Complement Component 3 Receptor 3 and 4 Subunit), CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7) (AP) discontinued

Sign In for Pricing
View Details
Asb6 AAV siRNA Pooled Vector
12516166 1.0 µg

Asb6 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
UBP25 rabbit pAb
RA35834-01 50 µL

UBP25 rabbit pAb

Sign In for Pricing
View Details
UBP25 rabbit pAb
RA35834-02 100 µL

UBP25 rabbit pAb

Sign In for Pricing
View Details