Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf163 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Chromosome 9 putative open reading frame 163

Gene Aliases

Uncharacterized protein C9orf163.

Gene ID

158055

Accession Number

NP_689784.1

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

MPGPLTCTPAWQGQGRAAAFLCCSFQRAGAVVGVPARWHRGRLSSQQRLRSSLGGSHPCPQLGRRLVREGVISVPRQQGRRRCRESFSPADVAPGPICSANICLSGVRFLTCLNRVREHVVGPSPSPAAPICFFPVVEALCTLRGRRCHCLPFPKRGMQRWMLPLRRGARLLPLASSKNPRARSPGLDPLGSSETLWSHRGGH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

C9orf163

Host or Source

Human

Protein Name

Uncharacterized protein C9orf163

Gene Name URL

C9orf163

Nucleotide Accession Number

NM_152571.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGR7 (RXFP1) (NM_021634) Human Tagged ORF Clone
RG211338 10 µg

LGR7 (RXFP1) (NM_021634) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Toxoplasma gondii Toxoplasma gondii Eukaryotic translation initiation factor 6 (EIF6)
MBS1210388-01 0.02 mg (E-Coli)

Recombinant Toxoplasma gondii Toxoplasma gondii Eukaryotic translation initiation factor 6 (EIF6)

Sign In for Pricing
View Details
Recombinant Toxoplasma gondii Toxoplasma gondii Eukaryotic translation initiation factor 6 (EIF6)
MBS1210388-02 0.1 mg (E-Coli)

Recombinant Toxoplasma gondii Toxoplasma gondii Eukaryotic translation initiation factor 6 (EIF6)

Sign In for Pricing
View Details
Recombinant Toxoplasma gondii Toxoplasma gondii Eukaryotic translation initiation factor 6 (EIF6)
MBS1210388-03 0.02 mg (Yeast)

Recombinant Toxoplasma gondii Toxoplasma gondii Eukaryotic translation initiation factor 6 (EIF6)

Sign In for Pricing
View Details
Recombinant Toxoplasma gondii Toxoplasma gondii Eukaryotic translation initiation factor 6 (EIF6)
MBS1210388-04 0.1 mg (Yeast)

Recombinant Toxoplasma gondii Toxoplasma gondii Eukaryotic translation initiation factor 6 (EIF6)

Sign In for Pricing
View Details
Recombinant Toxoplasma gondii Toxoplasma gondii Eukaryotic translation initiation factor 6 (EIF6)
MBS1210388-05 0.02 mg (Baculovirus)

Recombinant Toxoplasma gondii Toxoplasma gondii Eukaryotic translation initiation factor 6 (EIF6)

Sign In for Pricing
View Details