What is the catalog number for SMARCC1 Recombinant Protein?

The catalog number for SMARCC1 Recombinant Protein is OPCA02360-1MG.

What sizes are available for SMARCC1 Recombinant Protein?

SMARCC1 Recombinant Protein is available in the following size(s): 1 mg.

Is SMARCC1 Recombinant Protein in stock?

SMARCC1 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

SMARCC1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 1

Gene Aliases

BAF155; BRG1-associated factor 155; chromatin remodeling complex BAF155 subunit; CRACC1; mammalian chromatin remodeling complex BRG1-associated factor 155; Rsc8; SRG3; SWI/SNF complex 155 kDa subunit; SWI/SNF complex subunit SMARCC1; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1; SWI3.

Gene ID

6599

Accession Number

NP_003065.3

Reactivity

Homo sapiens|Human

Target

Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology) . Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. May stimulate the ATPase activity of the catalytic subunit of the complex (PubMed:10078207) . Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex) . During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF) . The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity) .

Type

Protein

Source

E.coli

Sequence

IPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.