What is the catalog number for N6AMT2 Recombinant Protein?

The catalog number for N6AMT2 Recombinant Protein is OPCA02357-20UG.

What sizes are available for N6AMT2 Recombinant Protein?

N6AMT2 Recombinant Protein is available in the following size(s): 20 µg.

Is N6AMT2 Recombinant Protein in stock?

N6AMT2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

N6AMT2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

EEF1A lysine methyltransferase 1

Gene Aliases

EEF1A lysine methyltransferase 1; ESP13; eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1; n (6) -adenine-specific DNA methyltransferase 2; N-6 adenine-specific DNA methyltransferase 2 (putative) ; N6AMT2; protein-lysine N-methyltransferase N6AMT2.

Gene ID

221143

Accession Number

NP_777588.1

Reactivity

Homo sapiens|Human

Target

Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-79'.

Type

Protein

Source

E.coli

Sequence

SDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

EEF1AKMT1

Host or Source

Human

Protein Name

EEF1A lysine methyltransferase 1

Gene Name URL

EEF1AKMT1

Nucleotide Accession Number

NM_174928.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

BNC680146-100 1x 100 µL