Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

N6AMT2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

EEF1A lysine methyltransferase 1

Gene Aliases

EEF1A lysine methyltransferase 1; ESP13; eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1; n (6) -adenine-specific DNA methyltransferase 2; N-6 adenine-specific DNA methyltransferase 2 (putative) ; N6AMT2; protein-lysine N-methyltransferase N6AMT2.

Gene ID

221143

Accession Number

NP_777588.1

Reactivity

Homo sapiens|Human

Target

Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-79'.

Type

Protein

Source

E.coli

Sequence

SDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

EEF1AKMT1

Host or Source

Human

Protein Name

EEF1A lysine methyltransferase 1

Gene Name URL

EEF1AKMT1

Nucleotide Accession Number

NM_174928.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MASP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F10]
TA812533BM 100 µL

MASP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F10]

Sign In for Pricing
View Details
Anti-SLC37A3 Antibody Picoband® Fluoro647 Conjugated
A14532-1-Fluoro647 100 µg/Vial

Anti-SLC37A3 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica Cytochrome oxidase assembly protein 3, mitochondrial (COA3)
MBS7011948-01 0.02 mg

Recombinant Yarrowia lipolytica Cytochrome oxidase assembly protein 3, mitochondrial (COA3)

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica Cytochrome oxidase assembly protein 3, mitochondrial (COA3)
MBS7011948-02 0.1 mg

Recombinant Yarrowia lipolytica Cytochrome oxidase assembly protein 3, mitochondrial (COA3)

Sign In for Pricing
View Details
Recombinant Yarrowia lipolytica Cytochrome oxidase assembly protein 3, mitochondrial (COA3)
MBS7011948-03 5x 0.1 mg

Recombinant Yarrowia lipolytica Cytochrome oxidase assembly protein 3, mitochondrial (COA3)

Sign In for Pricing
View Details
Human Phospholipase A2 Activating Protein (PLAA) Protein
abx068527-01 10 µg

Human Phospholipase A2 Activating Protein (PLAA) Protein

Sign In for Pricing
View Details