Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPMT1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Protein tyrosine phosphatase mitochondrial 1

Gene Aliases

DUSP23; MOSP; NB4 apoptosis/differentiation related protein; phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1; phosphoinositide lipid phosphatase; PLIP; PNAS-129; Protein-tyrosine phosphatase mitochondrial 1; PTEN-like phosphatase.

Gene ID

114971

Accession Number

NP_001137456.1

Reactivity

Homo sapiens|Human

Target

Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG) (By similarity) . PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle (By similarity) . Has also been shown to display phosphatase activity toward phosphoprotein substrates, specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production (By similarity) . Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues (By similarity) . Probably involved in regulation of insulin secretion in pancreatic beta cells (By similarity) . May prevent intrinsic apoptosis, probably by regulating mitochondrial membrane integrity (PubMed:24709986) .

Type

Protein

Source

E.coli

Sequence

KVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PTPMT1

Host or Source

Human

Protein Name

Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1

Gene Name URL

PTPMT1

Nucleotide Accession Number

NM_001143984.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNG11 Antibody
KC-46981-01 50 μL

GNG11 Antibody

Sign In for Pricing
View Details
GNG11 Antibody
KC-46981-02 100 µL

GNG11 Antibody

Sign In for Pricing
View Details
GNG11 Antibody
KC-46981-03 1 mL

GNG11 Antibody

Sign In for Pricing
View Details
ITPR3 Polyclonal Antibody
E-AB-16530-01 20 µL

ITPR3 Polyclonal Antibody

Sign In for Pricing
View Details
ITPR3 Polyclonal Antibody
E-AB-16530-02 60 µL

ITPR3 Polyclonal Antibody

Sign In for Pricing
View Details
ITPR3 Polyclonal Antibody
E-AB-16530-03 120 µL

ITPR3 Polyclonal Antibody

Sign In for Pricing
View Details