Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD300LF Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

CD300 molecule like family member f

Gene Aliases

CD300 antigen-like family member F; CD300f; CLM1; CLM-1; CMRF35-like molecule 1; IgSF13; immune receptor expressed on myeloid cells 1; immunoglobin superfamily member 13; immunoglobulin superfamily member 13; inhibitory receptor IREM1; IREM1; IREM-1; LMIR3; NK inhibitory receptor; NKIR.

Gene ID

146722

Accession Number

NP_001276011.1

Reactivity

Homo sapiens|Human

Target

Acts as an inhibitory receptor for myeloid cells and mast cells (PubMed:15549731) . Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is expressed on the surface of apoptotic cells. Plays an important role in the maintenance of immune homeostasis, by promoting macrophage-mediated efferocytosis and by inhibiting dendritic cell-mediated efferocytosis (By similarity) . Negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses via binding to ceramide and sphingomyelin which act as ligands (PubMed:24035150) . May act as a coreceptor for interleukin 4 (IL-4) . Associates with and regulates IL-4 receptor alpha-mediated responses by augmenting IL-4- and IL-13-induced signaling (By similarity) . Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through activation of PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:22043923) . Inhibits osteoclast formation. Induces macrophage cell death upon engagement (By similarity) .

Type

Protein

Source

E.coli

Sequence

TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CD300LF

Host or Source

Human

Protein Name

CMRF35-like molecule 1

Gene Name URL

CD300LF

Nucleotide Accession Number

NM_001289082.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dynactin 1 (A-2) FITC
sc-365274 FITC 200 µg/mL

Dynactin 1 (A-2) FITC

Sign In for Pricing
View Details
Rac1 Mouse Pre-designed siRNA Set A
HY-RS16742 1 Set

Rac1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal JNK2 Antibody [DyLight 350]
NBP2-98812UV 0.1 mL

Rabbit Polyclonal JNK2 Antibody [DyLight 350]

Sign In for Pricing
View Details
Human Probable arylformamidase (AFMID) ELISA Kit
KTE60956-01 48 Tests

Human Probable arylformamidase (AFMID) ELISA Kit

Sign In for Pricing
View Details
Human Probable arylformamidase (AFMID) ELISA Kit
KTE60956-02 96 Tests

Human Probable arylformamidase (AFMID) ELISA Kit

Sign In for Pricing
View Details
Human Probable arylformamidase (AFMID) ELISA Kit
KTE60956-03 5x 96 Tests

Human Probable arylformamidase (AFMID) ELISA Kit

Sign In for Pricing
View Details