Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Frataxin

Gene Aliases

Frataxin, mitochondrial; frda1.

Gene ID

102120656

Accession Number

NP_001271967.1

Reactivity

Cynomolgus Monkey|Macaca fascicularis

Target

Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe (2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe (2+) to Fe (3+) ; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1 (By similarity) .

Type

Protein

Source

E.coli

Sequence

SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FXN

Host or Source

Macaca fascicularis

Protein Name

Frataxin, mitochondrial

Gene Name URL

FXN

Nucleotide Accession Number

NM_001285038.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RNF26 Antibody [DyLight 350]
NBP2-81997UV 0.1 mL

Rabbit Polyclonal RNF26 Antibody [DyLight 350]

Sign In for Pricing
View Details
Porcine Interleukin 10 ELISA Kit
MBS026237-01 48 Well

Porcine Interleukin 10 ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 10 ELISA Kit
MBS026237-02 96 Well

Porcine Interleukin 10 ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 10 ELISA Kit
MBS026237-03 5x 96 Well

Porcine Interleukin 10 ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 10 ELISA Kit
MBS026237-04 10x 96 Well

Porcine Interleukin 10 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Estriol (E3) ELISA Kit
NSL0853Gp 96 Tests

Guinea pig Estriol (E3) ELISA Kit

Sign In for Pricing
View Details