Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ifne Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Interferon epsilon

Gene Aliases

If1ea; Ifn; Ifne1; IFN-epsilon; Ifnt1; Ifn-tau-1; Infe1; interferon 1ea; interferon epsilon; interferon epsilon 1; Interferon epsilon-1; interferon tau-1.

Gene ID

230405

Accession Number

NP_796322.1

Reactivity

Mouse|Mus musculus

Target

Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.

Type

Protein

Source

E.coli

Sequence

LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36 kda

Protein Length

Recombinant

NCBI Gene Symbol

Ifne

Host or Source

Mouse

Protein Name

Interferon epsilon

Gene Name URL

Ifne

Nucleotide Accession Number

NM_177348.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Tyrosine (6G6) Mouse Monoclonal Antibody
AMM03342-01 50 µL

Phospho-Tyrosine (6G6) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-Tyrosine (6G6) Mouse Monoclonal Antibody
AMM03342-02 100 µL

Phospho-Tyrosine (6G6) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-Tyrosine (6G6) Mouse Monoclonal Antibody
AMM03342-03 200 µL

Phospho-Tyrosine (6G6) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Easypro Mouse Amyloid Beta 1-40 (Aβ1-40) ELISA Kit
FY-EM2924S 96 Well

Easypro Mouse Amyloid Beta 1-40 (Aβ1-40) ELISA Kit

Sign In for Pricing
View Details
BPT LABELS 108 X 80 MM IN B-7610 Pre-sized Labels for Printers
800849 3000 Box (750 Label (s) x 4 Roll)

BPT LABELS 108 X 80 MM IN B-7610 Pre-sized Labels for Printers

Sign In for Pricing
View Details
NDUFV3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV712715 1.0 µg DNA

NDUFV3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details