Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ifne Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Interferon epsilon

Gene Aliases

If1ea; Ifn; Ifne1; IFN-epsilon; Ifnt1; Ifn-tau-1; Infe1; interferon 1ea; interferon epsilon; interferon epsilon 1; Interferon epsilon-1; interferon tau-1.

Gene ID

230405

Accession Number

NP_796322.1

Reactivity

Mouse|Mus musculus

Target

Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.

Type

Protein

Source

E.coli

Sequence

LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36 kda

Protein Length

Recombinant

NCBI Gene Symbol

Ifne

Host or Source

Mouse

Protein Name

Interferon epsilon

Gene Name URL

Ifne

Nucleotide Accession Number

NM_177348.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Diacylglycerol kinase epsilon (DGKE), partial
MBS952525 Inquire

Recombinant Human Diacylglycerol kinase epsilon (DGKE), partial

Sign In for Pricing
View Details
Anti-Mouse PDGFD Polyclonal Antibody
MV296014-01 50 µg

Anti-Mouse PDGFD Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse PDGFD Polyclonal Antibody
MV296014-02 100 µg

Anti-Mouse PDGFD Polyclonal Antibody

Sign In for Pricing
View Details
RAGE, CT (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (Biotin)
MBS6496751-01 0.2 mL

RAGE, CT (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (Biotin)

Sign In for Pricing
View Details
RAGE, CT (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (Biotin)
MBS6496751-02 5x 0.2 mL

RAGE, CT (Receptor for Advanced Glycosylation End Products, Advanced Glycosylation End Product-specific Receptor, AGER) (Biotin)

Sign In for Pricing
View Details
Alexa Fluor® 488 anti-mouse CD150 (SLAM)
E16F mg150-025U 25 µg

Alexa Fluor® 488 anti-mouse CD150 (SLAM)

Sign In for Pricing
View Details