What is the catalog number for S100A7A Recombinant Protein?

The catalog number for S100A7A Recombinant Protein is OPCA02336-20UG.

What sizes are available for S100A7A Recombinant Protein?

S100A7A Recombinant Protein is available in the following size(s): 20 µg.

Is S100A7A Recombinant Protein in stock?

S100A7A Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

S100A7A Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

S100 calcium binding protein A7A

Gene Aliases

Koebnerisin; NICE2; NICE-2; protein S100-A7A; S100 calcium-binding protein A15; S100 calcium-binding protein A7A; S100 calcium-binding protein A7-like 1; S100A15; S100A7f; S100A7L1.

Gene ID

338324

Reactivity

Homo sapiens|Human

Target

May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.

Type

Protein

Source

E.coli

Sequence

SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.