Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A7A Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

S100 calcium binding protein A7A

Gene Aliases

Koebnerisin; NICE2; NICE-2; protein S100-A7A; S100 calcium-binding protein A15; S100 calcium-binding protein A7A; S100 calcium-binding protein A7-like 1; S100A15; S100A7f; S100A7L1.

Gene ID

338324

Reactivity

Homo sapiens|Human

Target

May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.

Type

Protein

Source

E.coli

Sequence

SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

S100A7A

Host or Source

Human

Protein Name

Protein S100-A7A

Gene Name URL

S100A7A

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp29 Mouse Gene Knockout Kit (CRISPR)
KN518787 1 Kit

Usp29 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS806094 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF568 conjugate, 0.1mg/mL
BNC682130-500 1x 500 µL

Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS806455 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
VCX3A (NM_016379) Human Recombinant Protein
TP321002L 1 mg

VCX3A (NM_016379) Human Recombinant Protein

Sign In for Pricing
View Details
ETV3 Polyclonal Antibody
E-AB-17926-01 20 µL

ETV3 Polyclonal Antibody

Sign In for Pricing
View Details