Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ssb Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Single-stranded DNA-binding protein

Gene Aliases

BA_5722; BA5722; BAS5326.

Gene ID

1085491|2848521

Accession Number

NP_847868.2

Reactivity

Bacillus anthracis

Target

Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism.

Type

Protein

Source

E.coli

Sequence

MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLPF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BAS5326|ssb1

Host or Source

Bacillus anthracis

Protein Name

Single-stranded DNA-binding protein

Gene Name URL

BAS5326|ssb1

Nucleotide Accession Number

NC_003997.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Bub3 antibody
SLM-54413R-01 50 µL

Rabbit Anti-Bub3 antibody

Sign In for Pricing
View Details
Rabbit Anti-Bub3 antibody
SLM-54413R-02 100 µL

Rabbit Anti-Bub3 antibody

Sign In for Pricing
View Details
Recombinant allergen Art v 1 for Artemisia vulgaris (Mugwort pollen)
MBS505088-01 1 mg

Recombinant allergen Art v 1 for Artemisia vulgaris (Mugwort pollen)

Sign In for Pricing
View Details
Recombinant allergen Art v 1 for Artemisia vulgaris (Mugwort pollen)
MBS505088-02 5x 1 mg

Recombinant allergen Art v 1 for Artemisia vulgaris (Mugwort pollen)

Sign In for Pricing
View Details
Calcium glucoheptonate hydrate 97%
C01300 200 g

Calcium glucoheptonate hydrate 97%

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O1:K1/APEC mdoG Polyclonal Antibody
MBS7166914 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC mdoG Polyclonal Antibody

Sign In for Pricing
View Details