Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Delta like non-canonical Notch ligand 2

Gene Aliases

Delta-like 2 homolog; DLK-2; EGFL9; EGF-like protein 9; EGF-like-domain, multiple 9; epidermal growth factor-like protein 9; protein delta homolog 2.

Gene ID

65989

Accession Number

NP_001273584.1

Reactivity

Homo sapiens|Human

Target

Regulates adipogenesis.

Type

Protein

Source

E.coli

Sequence

DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

56.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DLK2

Host or Source

Human

Protein Name

Protein delta homolog 2

Gene Name URL

DLK2

Nucleotide Accession Number

NM_001286655.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR25, CT (WDR25, WD repeat-containing protein 25) (Azide free) (HRP)
MBS6363163-01 0.2 mL

WDR25, CT (WDR25, WD repeat-containing protein 25) (Azide free) (HRP)

Sign In for Pricing
View Details
WDR25, CT (WDR25, WD repeat-containing protein 25) (Azide free) (HRP)
MBS6363163-02 5x 0.2 mL

WDR25, CT (WDR25, WD repeat-containing protein 25) (Azide free) (HRP)

Sign In for Pricing
View Details
Tspan12 ORF Vector (Mouse) (pORF)
48581014 1.0 µg DNA

Tspan12 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
TTK, NT (Dual Specificity Protein Kinase TTK, Phosphotyrosine Picked Threonine-protein Kinase, PYT, MPS1, MPS1L1) (MaxLight 750)
MBS6504048-01 0.1 mL

TTK, NT (Dual Specificity Protein Kinase TTK, Phosphotyrosine Picked Threonine-protein Kinase, PYT, MPS1, MPS1L1) (MaxLight 750)

Sign In for Pricing
View Details
TTK, NT (Dual Specificity Protein Kinase TTK, Phosphotyrosine Picked Threonine-protein Kinase, PYT, MPS1, MPS1L1) (MaxLight 750)
MBS6504048-02 5x 0.1 mL

TTK, NT (Dual Specificity Protein Kinase TTK, Phosphotyrosine Picked Threonine-protein Kinase, PYT, MPS1, MPS1L1) (MaxLight 750)

Sign In for Pricing
View Details
PCTP L (STARD10) (NM_006645) Human Recombinant Protein
TP303228 20 µg

PCTP L (STARD10) (NM_006645) Human Recombinant Protein

Sign In for Pricing
View Details