Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG16L1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Autophagy related 16 like 1

Gene Aliases

APG16L; APG16L beta; APG16-like 1; ATG16 autophagy related 16-like 1; ATG16A; ATG16L; autophagy-related protein 16-1; IBD10; WD repeat domain 30; WDR30.

Gene ID

55054

Accession Number

NP_001177195.1

Reactivity

Homo sapiens|Human

Target

Plays an essential role in autophagy: interacts with ATG12-ATG5 to mediate the conjugation of phosphatidylethanolamine (PE) to LC3 (MAP1LC3A, MAP1LC3B or MAP1LC3C), to produce a membrane-bound activated form of LC3 named LC3-II. Thereby, controls the elongation of the nascent autophagosomal membrane (PubMed:24553140, PubMed:23376921, PubMed:24954904, PubMed:27273576, PubMed:23392225) . Regulates mitochondrial antiviral signaling (MAVS) -dependent type I interferon (IFN-I) production (PubMed:25645662) . Negatively regulates NOD1- and NOD2-driven inflammatory cytokine response (PubMed:24238340) . Instead, promotes with NOD2 an autophagy-dependent antibacterial pathway (PubMed:20637199) . Plays a role in regulating morphology and function of Paneth cell (PubMed:18849966) .

Type

Protein

Source

E.coli

Sequence

MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

84.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ATG16L1

Host or Source

Human

Protein Name

Autophagy-related protein 16-1

Gene Name URL

ATG16L1

Nucleotide Accession Number

NM_001190266.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

0.2 ml white 8-strip PCR tubes, separated flat caps
PCR8-0.2-B 125pcs/box, 10boxes/ctn

0.2 ml white 8-strip PCR tubes, separated flat caps

Sign In for Pricing
View Details
RAD21 Antibody
orb2677253-01 50 µL

RAD21 Antibody

Sign In for Pricing
View Details
RAD21 Antibody
orb2677253-02 100 µL

RAD21 Antibody

Sign In for Pricing
View Details
RAD21 Antibody
orb2677253-03 200 µL

RAD21 Antibody

Sign In for Pricing
View Details
Rabbit anti-Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083)(HIV-1) VIF Polyclonal Antibody
MBS7179914 Inquire

Rabbit anti-Human immunodeficiency virus type 1 group M subtype G (isolate 92NG083)(HIV-1) VIF Polyclonal Antibody

Sign In for Pricing
View Details
PMS2 Rabbit mAb, BF647 conjugated
orb2999965 100 µL

PMS2 Rabbit mAb, BF647 conjugated

Sign In for Pricing
View Details