Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LARP1B Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

La ribonucleoprotein 1B

Gene Aliases

La ribonucleoprotein domain family member 1B; La ribonucleoprotein domain family member 2; La ribonucleoprotein domain family, member 2; la-related protein 1B; la-related protein 2; LARP2.

Gene ID

55132

Accession Number

NP_001265533.1

Reactivity

Homo sapiens|Human

Target

This gene encodes a protein containing domains found in the La related protein of Drosophila melanogaster. La motif-containing proteins are thought to be RNA-binding proteins, where the La motif and adjacent amino acids fold into an RNA recognition motif. The La motif is also found in proteins unrelated to the La protein. Alternative splicing has been observed at this locus and multiple variants, encoding distinct isoforms, are described. Additional splice variation has been identified but the full-length nature of these transcripts has not been determined.

Type

Protein

Source

E.coli

Sequence

MDSRDRGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LARP1B

Host or Source

Human

Protein Name

La-related protein 1B

Gene Name URL

LARP1B

Nucleotide Accession Number

NM_001278604.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CYP11A1 antibody
STJ96588 200 µl

Anti-CYP11A1 antibody

Sign In for Pricing
View Details
Fukutin (FKTN) (NM_001079802) Human Mass Spec Standard
PH311422 10 µg

Fukutin (FKTN) (NM_001079802) Human Mass Spec Standard

Sign In for Pricing
View Details
Cis-5-Tetradecenoic acid
orb1983463-01 5 mg

Cis-5-Tetradecenoic acid

Sign In for Pricing
View Details
Cis-5-Tetradecenoic acid
orb1983463-02 50 mg

Cis-5-Tetradecenoic acid

Sign In for Pricing
View Details
MouseAPOA1 (ApolipoproteinA1) ELISAKit
ELK1304-01 48 Tests

MouseAPOA1 (ApolipoproteinA1) ELISAKit

Sign In for Pricing
View Details
MouseAPOA1 (ApolipoproteinA1) ELISAKit
ELK1304-02 96 Tests

MouseAPOA1 (ApolipoproteinA1) ELISAKit

Sign In for Pricing
View Details