Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arg1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Arginase, liver

Gene Aliases

AI; AI256583; Arg; Arg-1; arginase 1, liver; arginase I; arginase-1; liver-type arginase; PG; PGIF; type I arginase.

Gene ID

11846

Accession Number

NP_031508.1

Reactivity

Mouse|Mus musculus

Target

Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.

Type

Protein

Source

E.coli

Sequence

MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

50.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Arg1

Host or Source

Mouse

Protein Name

Arginase-1

Gene Name URL

Arg1

Nucleotide Accession Number

NM_007482.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)
MBS2078488-01 0.1 mL

PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)
MBS2078488-02 0.2 mL

PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)
MBS2078488-03 0.5 mL

PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)
MBS2078488-04 1 mL

PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)
MBS2078488-05 5 mL

PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)
MBS2078488-06 5x 5 mL

PE-Linked Polyclonal Antibody to RNA Binding Motif Protein 3 (RBM3)

Sign In for Pricing
View Details