Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEND3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

BEN domain containing 3

Gene Aliases

BEN domain-containing protein 3; KIAA1553.

Gene ID

57673

Accession Number

NP_001073919.1

Reactivity

Homo sapiens|Human

Target

Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its USP21-mediated deubiquitination (PubMed:21914818, PubMed:26100909) . Binds to unmethylated major satellite DNA and is involved in the recruitment of the Polycomb repressive complex 2 (PRC2) to major satellites (By similarity) . Stimulates the ERCC6L translocase and ATPase activities (PubMed:28977671) .

Type

Protein

Source

E.coli

Sequence

CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BEND3

Host or Source

Human

Protein Name

BEN domain-containing protein 3

Gene Name URL

BEND3

Nucleotide Accession Number

NM_001080450.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Tropomyosin-1 Antibody (TPM1/4510) [DyLight 650]
NBP3-27021C 0.1 mL

Mouse Monoclonal Tropomyosin-1 Antibody (TPM1/4510) [DyLight 650]

Sign In for Pricing
View Details
Recombinant Zaire ebolavirus Matrix protein VP40(VP40)
AP71367-01 20 µg

Recombinant Zaire ebolavirus Matrix protein VP40(VP40)

Sign In for Pricing
View Details
Recombinant Zaire ebolavirus Matrix protein VP40(VP40)
AP71367-02 100 µg

Recombinant Zaire ebolavirus Matrix protein VP40(VP40)

Sign In for Pricing
View Details
Recombinant Zaire ebolavirus Matrix protein VP40(VP40)
AP71367-03 1 mg

Recombinant Zaire ebolavirus Matrix protein VP40(VP40)

Sign In for Pricing
View Details
GABRR2 AAV siRNA Pooled Vector
21169161 1.0 µg

GABRR2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
KDM6A Rabbit Polyclonal Antibody (PerCP)
orb2494943 100 µL

KDM6A Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details