What is the catalog number for Nqo2 Recombinant Protein?

The catalog number for Nqo2 Recombinant Protein is OPCA02295-20UG.

What sizes are available for Nqo2 Recombinant Protein?

Nqo2 Recombinant Protein is available in the following size(s): 20 µg.

Is Nqo2 Recombinant Protein in stock?

Nqo2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Nqo2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

N-ribosyldihydronicotinamide:quinone reductase 2

Gene Aliases

NAD (P) H dehydrogenase, quinone 2; NAD (P) H quinone dehydrogenase 2; NRH dehydrogenase [quinone] 2; NRH:quinone oxidoreductase 2; QR2; quinone reductase 2; ribosyldihydronicotinamide dehydrogenase; ribosyldihydronicotinamide dehydrogenase [quinone].

Gene ID

291084

Accession Number

NP_001004214.1

Reactivity

Rat|Rattus norvegicus

Target

The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.

Type

Protein

Source

E.coli

Sequence

MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.