Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMUG1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Single-strand-selective monofunctional uracil-DNA glycosylase 1

Gene Aliases

FDG; HMUDG; single-strand selective monofunctional uracil DNA glycosylase; UNG3.

Gene ID

23583

Accession Number

NP_001230716.1

Reactivity

Homo sapiens|Human

Target

Recognizes base lesions in the genome and initiates base excision DNA repair. Acts as a monofunctional DNA glycosylase specific for uracil (U) residues in DNA with a preference for single-stranded DNA substrates. The activity is greater toward mismatches (U/G) compared to matches (U/A) . Excises uracil (U), 5-formyluracil (fU) and uracil derivatives bearing an oxidized group at C5 [5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU) ] in ssDNA and dsDNA, but not analogous cytosine derivatives (5-hydroxycytosine and 5-formylcytosine), nor other oxidized bases. The activity is damage-specific and salt-dependent. The substrate preference is the following: ssDNA > dsDNA (G pair) = dsDNA (A pair) at low salt concentration, and dsDNA (G pair) > dsDNA (A pair) > ssDNA at high salt concentration.

Type

Protein

Source

E.coli

Sequence

MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SMUG1

Host or Source

Human

Protein Name

Single-strand selective monofunctional uracil DNA glycosylase

Gene Name URL

SMUG1

Nucleotide Accession Number

NM_001243787.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTBP1 Polyclonal Antibody
E-AB-13175-01 20 µL

CTBP1 Polyclonal Antibody

Sign In for Pricing
View Details
CTBP1 Polyclonal Antibody
E-AB-13175-02 60 µL

CTBP1 Polyclonal Antibody

Sign In for Pricing
View Details
CTBP1 Polyclonal Antibody
E-AB-13175-03 120 µL

CTBP1 Polyclonal Antibody

Sign In for Pricing
View Details
CTBP1 Polyclonal Antibody
E-AB-13175-04 200 µL

CTBP1 Polyclonal Antibody

Sign In for Pricing
View Details
FITC Conjugated Goat Polyclonal Antibody to Human IgG
FA-2100-2 2 mL

FITC Conjugated Goat Polyclonal Antibody to Human IgG

Sign In for Pricing
View Details
Anti-RbcS | Ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (Algal)
AS22 4825 50 µg

Anti-RbcS | Ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (Algal)

Sign In for Pricing
View Details