Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C11orf73 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Heat shock protein nuclear import factor hikeshi

Gene Aliases

C11orf73; Hikeshi, heat shock protein nuclear import factor; HLD13; HSPC138; HSPC179; L7RN6; lethal, Chr 7, Rinchik 6; OPI10; protein Hikeshi.

Gene ID

51501

Accession Number

NP_057485.2

Reactivity

Homo sapiens|Human

Target

Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus.

Type

Protein

Source

E.coli

Sequence

MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HIKESHI

Host or Source

Human

Protein Name

Protein Hikeshi

Gene Name URL

HIKESHI

Nucleotide Accession Number

NM_016401.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAMBP Antibody
36099 100 µL

STAMBP Antibody

Sign In for Pricing
View Details
Mouse Threonine aspartase 1, Tasp1 ELISA KIT
ELI-52871m 96 Tests

Mouse Threonine aspartase 1, Tasp1 ELISA KIT

Sign In for Pricing
View Details
Canine ATP binding cassette sub family B member 6, mitochondrial (ABCB6) ELISA kit
GTR10460915 96 Well

Canine ATP binding cassette sub family B member 6, mitochondrial (ABCB6) ELISA kit

Sign In for Pricing
View Details
LGI3 (NM_139278) Human Over-expression Lysate
LC408334 20 µg

LGI3 (NM_139278) Human Over-expression Lysate

Sign In for Pricing
View Details
Human GBA shRNA Plasmid
abx951745-01 150 µg

Human GBA shRNA Plasmid

Sign In for Pricing
View Details
Human GBA shRNA Plasmid
abx951745-02 300 µg

Human GBA shRNA Plasmid

Sign In for Pricing
View Details