Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RALGPS1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Ral GEF with PH domain and SH3 binding motif 1

Gene Aliases

Ral GEF with PH domain and SH3-binding motif 1; ral guanine nucleotide exchange factor 2; Ral guanine nucleotide exchange factor RalGPS1A; ralA exchange factor RalGPS1; RALGEF2; RALGPS1A; ras-specific guanine nucleotide-releasing factor RalGPS1.

Gene ID

9649

Accession Number

NP_001177657.1

Reactivity

Homo sapiens|Human

Target

Guanine nucleotide exchange factor (GEF) for the small GTPase RALA. May be involved in cytoskeletal organization (By similarity) . Guanine nucleotide exchange factor for.

Type

Protein

Source

E.coli

Sequence

MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

50.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RALGPS1

Host or Source

Human

Protein Name

Ras-specific guanine nucleotide-releasing factor RalGPS1

Gene Name URL

RALGPS1

Nucleotide Accession Number

NM_001190728.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMOD3 CRISPR Knock Out 293T Cell Line (Human)
26917141 1x 10^6 Cells / 1.0 mL

LMOD3 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
KIF7 ORF Vector (Human) (pORF)
ORF013472 1.0 µg DNA

KIF7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
RPL31P62 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1966308 1.0 µg DNA

RPL31P62 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
KLF12 (AP2REP, Krueppel-like Factor 12, Transcriptional Repressor AP-2rep, HSPC122) (FITC)
MBS6147913-01 0.1 mL

KLF12 (AP2REP, Krueppel-like Factor 12, Transcriptional Repressor AP-2rep, HSPC122) (FITC)

Sign In for Pricing
View Details
KLF12 (AP2REP, Krueppel-like Factor 12, Transcriptional Repressor AP-2rep, HSPC122) (FITC)
MBS6147913-02 5x 0.1 mL

KLF12 (AP2REP, Krueppel-like Factor 12, Transcriptional Repressor AP-2rep, HSPC122) (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal CMP kinase Antibody
NBP2-33692 0.1 mL

Rabbit Polyclonal CMP kinase Antibody

Sign In for Pricing
View Details