Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BglIIM Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

N (4) - cytosine-specific methyltransferase BglII.

Reactivity

Bacillus subtilis

Target

This methylase recognizes the double-stranded sequence AGATCT, causes specific methylation on C-5 on both strands, and protects the DNA from cleavage by the BglII endonuclease.

Type

Protein

Source

E.coli

Sequence

MSEDQYKQIKLHLGMEDDNEDLPNHIPSSFPKQHLNKIYNGDTMNMLLDIPDNSVDLVVTSPPYNINKFKNDRRPLEEYLKWQTEIIEQCHRVLKPSGSIFWQVGTYVNDSGAHIPLDIRFFPIFESLGMFPRNRIVWVRPHGLHANKKFAGRHETILWFTKTPEYKFFLDPIRVPQKYANKKHYKGDKKGELSGDPLGKNPGDVWAFRNVRHNHEEDTIHPTQYPEDMIERIVLSTTEPNDIVLDPFIGMGTTASVAKNLNRYFYGAEIEKEYVDIAYQILSGEPDENNNFPNLKTLRQYCEKNGIIDPSQYTFTRQRKGSKPSLDSKAHPEEHHKKEIVERIEFEAENSVYKKVQNEQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

58 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BGLIIM

Host or Source

Bacillus subtilis

Protein Name

Modification methylase BglII

Gene Name URL

BGLIIM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Monoclonal Antibody to Complement Factor H (CFH)
MBS2164732-01 0.1 mL

PE-Linked Monoclonal Antibody to Complement Factor H (CFH)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Complement Factor H (CFH)
MBS2164732-02 0.2 mL

PE-Linked Monoclonal Antibody to Complement Factor H (CFH)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Complement Factor H (CFH)
MBS2164732-03 0.5 mL

PE-Linked Monoclonal Antibody to Complement Factor H (CFH)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Complement Factor H (CFH)
MBS2164732-04 1 mL

PE-Linked Monoclonal Antibody to Complement Factor H (CFH)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Complement Factor H (CFH)
MBS2164732-05 5 mL

PE-Linked Monoclonal Antibody to Complement Factor H (CFH)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Complement Factor H (CFH)
MBS2164732-06 5x 5 mL

PE-Linked Monoclonal Antibody to Complement Factor H (CFH)

Sign In for Pricing
View Details