Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADIPOQ Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Adiponectin, C1Q and collagen domain containing

Gene Aliases

30 kDa adipocyte complement-related protein; ACRP30; adipocyte complement related 30kDa protein; adipocyte complement related protein of 30 kDa; adipocyte complement-related 30 kDa protein; adipocyte, C1q and collagen domain-containing protein; adiponectin; adipose most abundant gene transcript 1 protein; apM-1; APM1.

Gene ID

282865

Accession Number

NP_777167.1

Reactivity

Bos taurus|Bovine

Target

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW (By similarity) .

Type

Protein

Source

E.coli

Sequence

EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ADIPOQ

Host or Source

Bovine

Protein Name

Adiponectin

Gene Name URL

ADIPOQ

Nucleotide Accession Number

NM_174742.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX21 (T-box Transcription Factor TBX21, T-box Protein 21, Transcription Factor TBLYM, T-cell-specific T-box Transcription Factor T-bet, TBET, TBLYM) (Azide Free) (FITC)
T1848-45A-FITC 100 µL

TBX21 (T-box Transcription Factor TBX21, T-box Protein 21, Transcription Factor TBLYM, T-cell-specific T-box Transcription Factor T-bet, TBET, TBLYM) (Azide Free) (FITC)

Sign In for Pricing
View Details
01/03/2010 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2781607 1.0 µg DNA

01/03/2010 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Nucleocapsid Antibody (8R738)
TMAY-02953-01 20 µL

Anti-SARS-CoV-2 Nucleocapsid Antibody (8R738)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Nucleocapsid Antibody (8R738)
TMAY-02953-02 100 µL

Anti-SARS-CoV-2 Nucleocapsid Antibody (8R738)

Sign In for Pricing
View Details
VSIG1 Polyclonal Antibody
E44H09925 100 µL

VSIG1 Polyclonal Antibody

Sign In for Pricing
View Details
AccuPower® Gold Multiplex PCR PreMix
K-2117 96 Reactions

AccuPower® Gold Multiplex PCR PreMix

Sign In for Pricing
View Details