Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAP3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Leucine aminopeptidase 3

Gene Aliases

Cysteinylglycine-S-conjugate dipeptidase; cytosol aminopeptidase; LAP; LAP-3; Leucine aminopeptidase 3; leucyl aminopeptidase; PEPS; peptidase S; proline aminopeptidase; prolyl aminopeptidase.

Gene ID

781648

Accession Number

NP_776523.2

Reactivity

Bos taurus|Bovine

Target

Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Type

Protein

Source

E.coli

Sequence

PGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFNKLVS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LAP3

Host or Source

Bovine

Protein Name

Cytosol aminopeptidase

Gene Name URL

LAP3

Nucleotide Accession Number

NM_174098.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

INos/Nos-2 Polyclonal Antibody, Cy3 Conjugated
bs-20601R-Cy3 100 µL

INos/Nos-2 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Recombinant Trichomonas vaginalis Protein SEY1 homolog 1 (TVAG_273580), partial
MBS1128270-01 1 mg (E-Coli)

Recombinant Trichomonas vaginalis Protein SEY1 homolog 1 (TVAG_273580), partial

Sign In for Pricing
View Details
Recombinant Trichomonas vaginalis Protein SEY1 homolog 1 (TVAG_273580), partial
MBS1128270-02 1 mg (Yeast)

Recombinant Trichomonas vaginalis Protein SEY1 homolog 1 (TVAG_273580), partial

Sign In for Pricing
View Details
CA5B Knockout NCI-H1299 Polyclonal Cells
ARG41660 1 Million

CA5B Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
Human TGM2 Matched Antibody Pair Set [ABP-S-04696]
ABP-S-04696 5 Plates

Human TGM2 Matched Antibody Pair Set [ABP-S-04696]

Sign In for Pricing
View Details
ZSCAN4 (Zinc Finger and SCAN Domain-containing Protein 4, Zinc Finger Protein 494, ZNF494) (FITC)
MBS6150622-01 0.1 mL

ZSCAN4 (Zinc Finger and SCAN Domain-containing Protein 4, Zinc Finger Protein 494, ZNF494) (FITC)

Sign In for Pricing
View Details