Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESRG Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

ESRG, HESRG, Embryonic stem cell-related gene protein, hES cell-related gene protein

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

MTLFSDSARLHPGEINSLVAHTKPVWWSLHTDAHEIWCRDSDRGTSLGRSIPCPPALCSVRKIHLRPQVLRPTSPRNISPISNPVSGLFLLCSPTSLTIPQPLSPFNLGATLQSLPSLNFNSFHSLVETKETCFIREPKTPAPVTDWEGSLPLVFNHCRDASLISRFRPRRDACLGPSPLAASPAFLGQGQVPLNPFSFTLSGKSRFSGAGASTPQPLLLHP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ESRG

Host or Source

Human

Protein Name

Embryonic stem cell-related gene protein

Gene Name URL

ESRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipocalin-1 LCN1 Rabbit Polyclonal Antibody (Fluoro550)
orb3082263 100 µg

Lipocalin-1 LCN1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Anti-Toll-like receptor 10 TLR10 Antibody Picoband® Fluoro488 Conjugated
PA1958-Fluoro488 100 µg/Vial

Anti-Toll-like receptor 10 TLR10 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
2B4/CD244 Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPY-06280-01 5 µg

2B4/CD244 Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
2B4/CD244 Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPY-06280-02 10 µg

2B4/CD244 Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
2B4/CD244 Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPY-06280-03 20 µg

2B4/CD244 Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details
2B4/CD244 Protein, Human, Recombinant (hFc & Avi), Biotinylated
TMPY-06280-04 50 µg

2B4/CD244 Protein, Human, Recombinant (hFc & Avi), Biotinylated

Sign In for Pricing
View Details