Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF12 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

TATA-box binding protein associated factor 12

Gene Aliases

TAF12 RNA polymerase II, TATA box binding protein (TBP) -associated factor, 20kDa; TAF2J; TAFII20; TAFII20/TAFII15; TAFII-20/TAFII-15; TATA box binding protein (TBP) -associated factor, RNA polymerase II, J, 20kD; transcription initiation factor TFIID 20/15 kDa subunits; transcription initiation factor TFIID subunit 12.

Gene ID

6883

Accession Number

NP_001128690.1

Reactivity

Homo sapiens|Human

Target

TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC) . TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.

Type

Protein

Source

E.coli

Sequence

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TAF12

Host or Source

Human

Protein Name

Transcription initiation factor TFIID subunit 12

Gene Name URL

TAF12

Nucleotide Accession Number

NM_001135218.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transglutaminase 4/TGM4 Overexpression Lysate (Native) - (Dry Ice)
NBL1-16868 0.1 mg

Transglutaminase 4/TGM4 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi B 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)
MBS1178075-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi B 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi B 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)
MBS1178075-02 0.02 mg (Yeast)

Recombinant Salmonella paratyphi B 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi B 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)
MBS1178075-03 0.1 mg (E-Coli)

Recombinant Salmonella paratyphi B 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi B 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)
MBS1178075-04 0.1 mg (Yeast)

Recombinant Salmonella paratyphi B 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi B 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)
MBS1178075-05 0.02 mg (Baculovirus)

Recombinant Salmonella paratyphi B 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)

Sign In for Pricing
View Details