What is the catalog number for TAF12 Recombinant Protein?

The catalog number for TAF12 Recombinant Protein is OPCA02270-1MG.

What sizes are available for TAF12 Recombinant Protein?

TAF12 Recombinant Protein is available in the following size(s): 1 mg.

Is TAF12 Recombinant Protein in stock?

TAF12 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

TAF12 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

TATA-box binding protein associated factor 12

Gene Aliases

TAF12 RNA polymerase II, TATA box binding protein (TBP) -associated factor, 20kDa; TAF2J; TAFII20; TAFII20/TAFII15; TAFII-20/TAFII-15; TATA box binding protein (TBP) -associated factor, RNA polymerase II, J, 20kD; transcription initiation factor TFIID 20/15 kDa subunits; transcription initiation factor TFIID subunit 12.

Gene ID

6883

Accession Number

NP_001128690.1

Reactivity

Homo sapiens|Human

Target

TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC) . TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.

Type

Protein

Source

E.coli

Sequence

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.