Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SART3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Spliceosome associated factor 3, U4/U6 recycling protein

Gene Aliases

DSAP1; HIV-1 Tat-interacting protein of 110kDa; hSART-3; P100; p110; p110 nuclear RNA-binding protein; p110 (nrb) ; PRP24 homolog; RP11-13G14; SART-3; squamous cell carcinoma antigen recognized by T cells 3; squamous cell carcinoma antigen recognized by T-cells 3; tat-interacting protein of 110 kDa; TIP110.

Gene ID

9733

Accession Number

NP_055521.1

Reactivity

Homo sapiens|Human

Target

U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassembly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation (PubMed:12032085) . Also binds U6atac snRNPs and may function as a recycling factor for U4atac/U6atac spliceosomal snRNP, an initial step in the assembly of U12-type spliceosomal complex. The U12-type spliceosomal complex plays a role in the splicing of introns with non-canonical splice sites (PubMed:14749385) . May also function as a substrate-targeting factor for deubiquitinases like USP4 and USP15. Recruits USP4 to ubiquitinated PRPF3 within the U4/U5/U6 tri-snRNP complex, promoting PRPF3 deubiquitination and thereby regulating the spliceosome U4/U5/U6 tri-snRNP spliceosomal complex disassembly (PubMed:20595234) . May also recruit the deubiquitinase USP15 to histone H2B and mediate histone deubiquitination, thereby regulating gene expression and/or DNA repair (PubMed:24526689) . May play a role in hematopoiesis probably through transcription regulation of specific genes including MYC (By similarity) .

Type

Protein

Source

E.coli

Sequence

QRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

49.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SART3

Host or Source

Human

Protein Name

Squamous cell carcinoma antigen recognized by T-cells 3

Gene Name URL

SART3

Nucleotide Accession Number

NM_014706.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT3, ID (KRT3, Keratin, type II cytoskeletal 3, 65kD cytokeratin, Cytokeratin-3, Keratin-3, Type-II keratin Kb3)
037615 200 µL

KRT3, ID (KRT3, Keratin, type II cytoskeletal 3, 65kD cytokeratin, Cytokeratin-3, Keratin-3, Type-II keratin Kb3)

Sign In for Pricing
View Details
Rabbit Polyclonal GANC Antibody
NBP3-03889-20ul 20 µL

Rabbit Polyclonal GANC Antibody

Sign In for Pricing
View Details
YIPF7 AAV Vector (Mouse) (CMV)
50617104 1 µg

YIPF7 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Cy5 Conjugated Affinity Purified anti-Rabbit IgG [H&L] [Goat]
SC014 250 µg

Cy5 Conjugated Affinity Purified anti-Rabbit IgG [H&L] [Goat]

Sign In for Pricing
View Details
Olr880 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7157008 1.0 µg DNA

Olr880 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Topoisomerase I/II Inhibitor 2
MBS5803756 Inquire

Topoisomerase I/II Inhibitor 2

Sign In for Pricing
View Details